-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PRX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human PRX (NP_870998.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PRX was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human PRX (NP_870998.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07066A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PRX |
| Target Synonyms | CMT4F; PRX | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1250-1350 of human PRX (NP_870998.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LGARARVGGEGAEEQPPGAERTFCLSLPDVELSPSGGNHAEYQVAEGEGEAGHKLKVRLPRFGLVRAKEGAEEGEKAKSPKLRLPRVGFSQSEMVTGEGSP | Uniprot ID | Q9BXM0 |
Uniprot Id
Q9BXM0
Target Species
Human
Target Name
PRX
Target Full Name
Periaxin
Target Function
Scaffolding protein that functions as part of a dystroglycan complex in Schwann cells, and as part of EZR and AHNAK-containing complexes in eye lens fiber cells. Required for the maintenance of the peripheral myelin sheath that is essential for normal transmission of nerve impulses and normal perception of sensory stimuli. Required for normal transport of MBP mRNA from the perinuclear to the paranodal regions. Required for normal remyelination after nerve injury. Required for normal elongation of Schwann cells and normal length of the internodes between the nodes of Ranvier. The demyelinated nodes of Ranvier permit saltatory transmission of nerve impulses; shorter internodes cause slower transmission of nerve impulses. Required for the formation of appositions between the abaxonal surface of the myelin sheath and the Schwann cell plasma membrane; the Schwann cell cytoplasm is restricted to regions between these appositions. Required for the formation of Cajal bands and of Schmidt-Lanterman incisures that correspond to short, cytoplasm-filled regions on myelinated nerves. Recruits DRP2 to the Schwann cell plasma membrane. Required for normal protein composition of the eye lens fiber cell plasma membrane and normal eye lens fiber cell morphology.
Target Involvement
Dejerine-Sottas syndrome (DSS); Charcot-Marie-Tooth disease 4F (CMT4F)
Target Subcellular Location
[Isoform 1]: Cell membrane; Peripheral membrane protein; Cytoplasmic side. Nucleus. Cytoplasm.; [Isoform 2]: Cytoplasm.; Cell membrane. Cell junction.
Target Protein Families
Periaxin family
Target Tissue Specificity
Detected in spinal cord. Isoform 1 and isoform 2 are found in sciatic nerve and Schwann cells.
Target Synonyms
CMT4F; KIAA1620; Periaxin; PRAX_HUMAN; Prx
Target Background
This gene encodes a protein involved in peripheral nerve myelin upkeep. The encoded protein contains 2 PDZ domains which were named after PSD95 (post synaptic density protein), DlgA (Drosophila disc large tumor suppressor), and ZO1 (a mammalian tight junction protein). Two alternatively spliced transcript variants have been described for this gene which encode different protein isoforms and which are targeted differently in the Schwann cell. Mutations in this gene cause Charcot-Marie-Tooth neuoropathy, type 4F and Dejerine-Sottas neuropathy.
Notification