Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PSD2 (NP_115665.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSD2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PSD2 (NP_115665.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05646A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSD2 |
| Target Synonyms | EFA6C; PSD2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, U-251MG, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human PSD2 (NP_115665.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD | Uniprot ID | Q9BQI7 |
Uniprot Id
Q9BQI7
Target Species
Human
Target Name
PSD2
Target Full Name
PH and SEC7 domain-containing protein 2
Target Subcellular Location
Cell membrane; Single-pass membrane protein. Cell projection, ruffle membrane. Cleavage furrow.
Target Protein Families
PSD family
Target Synonyms
PSD2; EFA6C; PH and SEC7 domain-containing protein 2; Exchange factor for ADP-ribosylation factor guanine nucleotide factor 6 C; Exchange factor for ARF6 C; Pleckstrin homology and SEC7 domain-containing protein 2
Target Background
Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in cleavage furrow and ruffle membrane. Predicted to be active in glutamatergic synapse and postsynapse.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
