-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 794-953 of human PSMD1 (NP_002798.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PSMD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 794-953 of human PSMD1 (NP_002798.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10778A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMD1 |
| Target Synonyms | S1; P112; Rpn2; PSMD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Jurkat | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 794-953 of human PSMD1 (NP_002798.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DLKMPKVQYKSNCKPSTFAYPAPLEVPKEKEKEKVSTAVLSITAKAKKKEKEKEKKEEEKMEVDEAEKKEEKEKKKEPEPNFQLLDNPARVMPAQLKVLTMPETCRYQPFKPLSIGGIIILKDTSEDIEELVEPVAAHGPKIEEEEQEPEPPEPFEYIDD | Uniprot ID | Q99460 |
Uniprot Id
Q99460
Target Species
Human
Target Name
PSMD1
Target Full Name
26S proteasome non-ATPase regulatory subunit 1
Target Function
Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which could impair cellular functions, and by removing proteins whose functions are no longer required. Therefore, the proteasome participates in numerous cellular processes, including cell cycle progression, apoptosis, or DNA damage repair.
Target Protein Families
Proteasome subunit S1 family
Target Synonyms
MGC133041; 26S proteasome non ATPase regulatory subunit 1; 26S proteasome non ATPase subunit 1; 26S proteasome non-ATPase regulatory subunit 1; 26S proteasome regulatory subunit rpn2; 26S proteasome regulatory subunit S1; 26S proteasome subunit p112; MGC133040; P112; Proteasome (prosome macropain) 26S subunit, non ATPase 1; Psmd1; PSMD1_HUMAN; RPN2; S1
Target Background
The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes the largest non-ATPase subunit of the 19S regulator lid, which is responsible for substrate recognition and binding. There is evidence that this proteasome and its subunits interact with viral proteins, including those of coronaviruses. Alternatively spliced transcript variants have been found for this gene.
Notification