-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSPC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PSPC1 (NP_001035879.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
The antibody against PSPC1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PSPC1 (NP_001035879.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ELISA.
| Cat.No | ADA-11610A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSPC1 |
| Target Synonyms | PSP1; PSPC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, BxPC-3, Mouse brain, U-87MG | Application | ELISA, WB, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PSPC1 (NP_001035879.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMLRGNLKQVRIEKNPARLRALESAVGESEPAAAAAMALALAGEPAPPAPAPPEDHPDEEMGFTIDIKSF | Uniprot ID | Q8WXF1 |
Uniprot Id
Q8WXF1
Target Species
Human
Target Name
PSPC1
Target Full Name
Paraspeckle component 1
Target Function
Regulates, cooperatively with NONO and SFPQ, androgen receptor-mediated gene transcription activity in Sertoli cell line. Binds to poly(A), poly(G) and poly(U) RNA homopolymers. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer. Together with NONO, required for the formation of nuclear paraspeckles. Plays a role in the regulation of DNA virus-mediated innate immune response by assembling into the HDP-RNP complex, a complex that serves as a platform for IRF3 phosphorylation and subsequent innate immune response activation through the cGAS-STING pathway.
Target Subcellular Location
Nucleus, nucleolus. Nucleus matrix. Cytoplasm. Nucleus speckle. Note=In punctate subnuclear structures often located adjacent to splicing speckles, called paraspeckles. Colocalizes with NONO and SFPQ in paraspeckles and perinucleolar caps in an RNA-dependent manner. May cycle between paraspeckles and nucleolus. In telophase, when daughter nuclei form, localizes to perinucleolar caps.
Target Protein Families
PSPC family
Target Tissue Specificity
Expressed in pancreas, kidney, skeletal muscle, liver, lung, placenta, brain and heart.
Target Synonyms
Paraspeckle component 1; Paraspeckle protein 1; PSP1; Pspc1; PSPC1_HUMAN
Target Background
This gene encodes a nucleolar protein that localizes to punctate subnuclear structures that occur close to splicing speckles, known as paraspeckles. These paraspeckles are composed of RNA-protein structures that include a non-coding RNA, NEAT1/Men epsilon/beta, and the Drosophila Behavior Human Splicing family of proteins, which include the product of this gene and the P54NRB/NONO and PSF/SFPQ proteins. Paraspeckles may function in the control of gene expression via an RNA nuclear retention mechanism. The protein encoded by this gene is found in paraspeckles in transcriptionally active cells, but it localizes to unique cap structures at the nucleolar periphery when RNA polymerase II transcription is inhibited, or during telophase. Alternative splicing of this gene results in multiple transcript variants. A related pseudogene, which is also located on chromosome 13, has been identified.
Notification