Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTDSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PTDSS1 (NP_055569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTDSS1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PTDSS1 (NP_055569.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-09576A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTDSS1 |
| Target Synonyms | LMHD; PSS1; PSSA; PTDSS1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human PTDSS1 (NP_055569.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTIVSLMYFAFTRDDSVPEDNIW | Uniprot ID | P48651 |
Uniprot Id
P48651
Target Species
Human
Target Name
PTDSS1
Target Full Name
Phosphatidylserine synthase 1
Target Function
Catalyzes a base-exchange reaction in which the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. Catalyzes mainly the conversion of phosphatidylcholine. Also converts, in vitro and to a lesser extent, phosphatidylethanolamine.
Target Involvement
Lenz-Majewski hyperostotic dwarfism (LMHD)
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
Phosphatidyl serine synthase family
Target Research Area
Metabolism
Target Synonyms
PTDSS1; KIAA0024; PSSA; Phosphatidylserine synthase 1; PSS-1; PtdSer synthase 1; EC 2.7.8.29; Serine-exchange enzyme I
Target Background
The protein encoded by this gene catalyzes the formation of phosphatidylserine from either phosphatidylcholine or phosphatidylethanolamine. Phosphatidylserine localizes to the mitochondria-associated membrane of the endoplasmic reticulum, where it serves a structural role as well as a signaling role. Defects in this gene are a cause of Lenz-Majewski hyperostotic dwarfism. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
