-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTHLH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTHLH was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12162A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTHLH |
| Target Synonyms | HHM; PLP; BDE2; PTHR; PTHRP; PTHLH | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 25-175 of human PTHLH (NP_945315.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RSVEGLSRRLKRAVSEHQLLHDKGKSIQDLRRRFFLHHLIAEIHTAEIRATSEVSPNSKPSPNTKNHPVRFGSDDEGRYLTQETNKVETYKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLSDTSTTSLELDSR | Uniprot ID | P12272 |
Uniprot Id
P12272
Target Species
Human
Target Name
PTHLH
Target Full Name
Parathyroid hormone-related protein
Target Function
Neuroendocrine peptide which is a critical regulator of cellular and organ growth, development, migration, differentiation and survival and of epithelial calcium ion transport. Regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. Required for skeletal homeostasis. Promotes mammary mesenchyme differentiation and bud outgrowth by modulating mesenchymal cell responsiveness to BMPs. Upregulates BMPR1A expression in the mammary mesenchyme and this increases the sensitivity of these cells to BMPs and allows them to respond to BMP4 in a paracrine and/or autocrine fashion. BMP4 signaling in the mesenchyme, in turn, triggers epithelial outgrowth and augments MSX2 expression, which causes the mammary mesenchyme to inhibit hair follicle formation within the nipple sheath. Promotes colon cancer cell migration and invasion in an integrin alpha-6/beta-1-dependent manner through activation of Rac1.; Osteostatin is a potent inhibitor of osteoclastic bone resorption.
Target Involvement
Brachydactyly E2 (BDE2)
Target Subcellular Location
Cytoplasm. Nucleus. Secreted.
Target Protein Families
Parathyroid hormone family
Target Tissue Specificity
Ubiquitous. Also expressed in the mammary gland.
Target Research Area
Signal Transduction
Target Synonyms
HHM; MGC14611; Osteostatin; Parathyroid hormon like hormone isoform 2 preproprotein; Parathyroid hormone like hormone; Parathyroid hormone like hormone isoform 1 preproprotein; Parathyroid hormone like protein; Parathyroid hormone like related protein; Parathyroid hormone related protein; Parathyroid hormone-like protein; Parathyroid like protein; PLP; PTH related protein; PTH-rP; PTHLH; PTHR; PTHR_HUMAN; PTHrP; PTHrP[107-139]
Target Background
The protein encoded by this gene is a member of the parathyroid hormone family. This hormone, via its receptor, PTHR1, regulates endochondral bone development and epithelial-mesenchymal interactions during the formation of the mammary glands and teeth. It is responsible for most cases of humoral hypercalcemia of malignancy, and mutations in this gene are associated with brachydactyly type E2 (BDE2). Alternatively spliced transcript variants have been found for this gene. There is also evidence for alternative translation initiation from non-AUG (CUG and GUG) start sites, downstream of the initiator AUG codon, resulting in nuclear forms of this hormone.
Notification