Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTOV1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTOV1 (NP_001292037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTOV1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTOV1 (NP_001292037.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-04622A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTOV1 |
| Target Synonyms | ACID2; PTOV-1; PTOV1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PTOV1 (NP_001292037.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MRSPAVPTPARGQLGVAFVLLPPHSEGARVFGALGPIGPSSPGLTLGGLAVSEHRLSNKLLAWSGVLEWQEKRRPYSDSTAKLKRTLPCQAYVNQGENLE | Uniprot ID | Q86YD1 |
Uniprot Id
Q86YD1
Target Species
Human
Target Name
PTOV1
Target Full Name
Prostate tumor-overexpressed gene 1 protein
Target Function
May activate transcription. Required for nuclear translocation of FLOT1. Promotes cell proliferation.
Target Subcellular Location
Cytoplasm. Nucleus. Cell membrane. Cytoplasm, perinuclear region.
Target Protein Families
Mediator complex subunit 25 family, PTOV1 subfamily
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, placenta, skeletal muscle and small intestine.
Target Synonyms
PTOV1; ACID2; PP642; UNQ6127/PRO20092; Prostate tumor-overexpressed gene 1 protein; PTOV-1; Activator interaction domain-containing protein 2
Target Background
This gene encodes a protein that was found to be overexpressed in prostate adenocarcinomas. The encoded protein was found to interact with the lipid raft protein flotillin-1 and shuttle it from the cytoplasm to the nucleus in a cell cycle dependent manner. Alternative splicing of this gene results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
