-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PTP4A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PTP4A1 (NP_003454.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PTP4A1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PTP4A1 (NP_003454.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02325A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PTP4A1 |
| Target Synonyms | HH72; PRL1; PRL-1; PTPCAAX1; PTP(CAAX1); PTP4A1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, Mouse liver, Rat liver, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-173 of human PTP4A1 (NP_003454.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MARMNRPAPVEVTYKNMRFLITHNPTNATLNKFIEELKKYGVTTIVRVCEATYDTTLVEKEGIHVLDWPFDDGAPPSNQIVDDWLSLVKIKFREEPGCCIAVHCVAGLGRAPVLVALALIEGGMKYEDAVQFIRQKRRGAFNSKQLLYLEKYRPKMRLRFKDSNGHRNNCCIQ | Uniprot ID | Q93096 |
Uniprot Id
Q93096
Target Species
Human
Target Name
PTP4A1
Target Full Name
Protein tyrosine phosphatase type IVA 1
Target Function
Protein tyrosine phosphatase which stimulates progression from G1 into S phase during mitosis. May play a role in the development and maintenance of differentiating epithelial tissues. Enhances cell proliferation, cell motility and invasive activity, and promotes cancer metastasis.
Target Subcellular Location
Cell membrane; Lipid-anchor. Early endosome. Endoplasmic reticulum. Cytoplasm. Cytoplasm, cytoskeleton, spindle. Nucleus.
Target Protein Families
Protein-tyrosine phosphatase family
Target Tissue Specificity
Expressed in bone marrow, lymph nodes, T lymphocytes, spleen, thymus and tonsil. Overexpressed in tumor cell lines.
Target Synonyms
HH 72; HH72; Hypothetical protein DKFZp779M0721 ; Phosphatase of regenerating liver 1; PRL 1; PRL-1; PRL1; Protein tyrosine phosphatase PTPCAAX1; Protein tyrosine phosphatase type IVA 1; Protein tyrosine phosphatase type IVA member 1; Protein-tyrosine phosphatase 4a1; Protein-tyrosine phosphatase of regenerating liver 1; Protein-tyrosine phosphatase; type 4A; 1; PTP(CAAXI); Ptp4a1; PTPCAAX1; TP4A1_HUMAN
Target Background
This gene encodes a member of a small class of prenylated protein tyrosine phosphatases (PTPs), which contain a PTP domain and a characteristic C-terminal prenylation motif. The encoded protein is a cell signaling molecule that plays regulatory roles in a variety of cellular processes, including cell proliferation and migration. The protein may also be involved in cancer development and metastasis. This tyrosine phosphatase is a nuclear protein, but may associate with plasma membrane by means of its prenylation motif. Pseudogenes related to this gene are located on chromosomes 1, 2, 5, 7, 11 and X.
Notification