Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PWP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PWP1 (NP_008993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PWP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PWP1 (NP_008993.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00665A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PWP1 |
| Target Synonyms | NCLB; IEF-SSP-9502; PWP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, Mouse liver | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human PWP1 (NP_008993.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNRSRQVTCVAWVRCGVAKETPDKVELSKEEVKRLIAEAKEKLQEEGGGSDEEETGSPSEDGMQSARTQARPREPLEDGDPEDDRTLDDDELAEYDLDKYDEEGDPDAETLGESLLGLTV | Uniprot ID | Q13610 |
Uniprot Id
Q13610
Target Species
Human
Target Name
PWP1
Target Full Name
Periodic tryptophan protein 1 homolog
Target Function
Chromatin-associated factor that regulates transcription. Regulates Pol I-mediated rRNA biogenesis and, probably, Pol III-mediated transcription. Regulates the epigenetic status of rDNA.
Target Subcellular Location
Nucleus. Nucleus, nucleolus. Chromosome.
Target Protein Families
WD repeat PWP1 family
Target Tissue Specificity
High levels seen in the placenta, skeletal muscle, kidney and pancreas while lower levels were seen in the heart, brain and lung.
Target Synonyms
Keratinocyte protein IEF SSP 9502; Periodic tryptophan protein 1 homolog; PWP1; PWP1 homolog; PWP1_HUMAN
Target Background
The protein encoded by this gene contains several WD-40 repeats and is found mostly in the nucleus. The expression and localization of this protein are cell cycle dependent. Expression of this gene is upregulated in pancreatic adenocarcinoma. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
