Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PWP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 740-919 of human PWP2 (NP_005040.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PWP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 740-919 of human PWP2 (NP_005040.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-03621A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PWP2 |
| Target Synonyms | UTP1; PWP2H; EHOC-17; PWP2 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, K-562, Mouse thymus, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 740-919 of human PWP2 (NP_005040.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELDTSVTPGRVREALRQQDFTRAILMALRLNESKLVQEALEAVPRGEIEVVTSSLPELYVEKVLEFLASSFEVSRHLEFYLLWTHKLLMLHGQKLKSRAGTLLPVIQFLQKSIQRHLDDLSKLCSWNHYNMQYALAVSKQRGTKRSLDPLGSEEEAEASEDDSLHLLGGGGRDSEEEMLA | Uniprot ID | Q15269 |
Uniprot Id
Q15269
Target Species
Human
Target Name
PWP2
Target Full Name
Periodic tryptophan protein 2 homolog
Target Subcellular Location
Nucleus, nucleolus.
Target Protein Families
WD repeat PWP2 family
Target Synonyms
PWP2; PWP2H; Periodic tryptophan protein 2 homolog
Target Background
Enables RNA binding activity. Predicted to be involved in maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) and ribosomal small subunit assembly. Predicted to be located in nucleoplasm. Predicted to be part of Pwp2p-containing subcomplex of 90S preribosome and small-subunit processome.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
