Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PXDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1320-1479 of human PXDN (NP_036425.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PXDN was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1320-1479 of human PXDN (NP_036425.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-12037A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PXDN |
| Target Synonyms | PXN; VPO; MG50; PRG2; ASGD7; COPOA; D2S448; D2S448E; hsPxd01; PXDN | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Raji | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1320-1479 of human PXDN (NP_036425.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RTRGQFNAFSYHFRGRRSLEFSYQEDKPTKKTRPRKIPSVGRQGEHLSNSTSAFSTRSDASGTNDFREFVLEMQKTITDLRTQIKKLESRLSTTECVDAGGESHANNTKWKKDACTICECKDGQVTCFVEACPPATCAVPVNIPGACCPVCLQKRAEEKP | Uniprot ID | Q92626 |
Uniprot Id
Q92626
Target Species
Human
Target Name
PXDN
Target Full Name
Peroxidasin homolog
Target Function
Displays low peroxidase activity and is likely to participate in H(2)O(2) metabolism and peroxidative reactions in the cardiovascular system. Plays a role in extracellular matrix formation.
Target Involvement
Anterior segment dysgenesis 7 (ASGD7)
Target Subcellular Location
Secreted, extracellular space, extracellular matrix. Note=Enriched in the peritubular space of fibrotic kidneys.
Target Protein Families
Peroxidase family, XPO subfamily
Target Tissue Specificity
Expressed at higher levels in heart, lung, ovary, spleen, intestine and placenta, and at lower levels in liver, colon, pancreas, kidney, thymus, skeletal muscle and prostate. Expressed in tumors such as melanoma, breast cancer, ovarian cancer and glioblas
Target Synonyms
PXDN; KIAA0230; MG50; PRG2; VPO; VPO1; Peroxidasin homolog; EC 1.11.1.7; Melanoma-associated antigen MG50; Vascular peroxidase 1; p53-responsive gene 2 protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
