-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PXK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PXK (NP_060241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PXK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PXK (NP_060241.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05044A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PXK |
| Target Synonyms | SLOB; MONAKA; PXK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, Jurkat, Mouse lung, Mouse spleen, Rat kidney, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human PXK (NP_060241.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFMEKPPAGKVLLDDTVPLTAAIEASQSLQSHTEYIIRVQRGISVENSWQIVRRYSDFDLLNNSLQIAGLSLPLPPKKLIGNMDREFIAERQKGLQNYLNVITTNHILSNCELVKKFLDPNNYSANYTEIALQQVSMFFRSEPKWEVVEPLKDIGWRIRKKYFLMKIKNQPKERLVLSWADLGPDKYLSDKDFQCLIKL | Uniprot ID | Q7Z7A4 |
Uniprot Id
Q7Z7A4
Target Species
Human
Target Name
PXK
Target Full Name
PX domain-containing protein kinase-like protein
Target Function
Binds to and modulates brain Na,K-ATPase subunits ATP1B1 and ATP1B3 and may thereby participate in the regulation of electrical excitability and synaptic transmission. May not display kinase activity.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein. Note=Also associates with the plasma membrane. Isoform 3 is present throughout the cell.
Target Protein Families
Protein kinase superfamily
Target Tissue Specificity
Widely expressed in all tissues examined except in heart. Isoform 1 is expressed in high levels in the brain, skeletal muscle, spleen and testis. Isoform 7 expression has yet to be demonstrated.
Target Synonyms
FLJ20335; K-ATPase; Modulator of Na; Modulator of Na K ATPase ; Modulator of Na K ATPase long form ; MONaKA; PX domain containing protein kinase like protein ; PX domain containing serine/threonine kinase ; PX domain-containing protein kinase-like protein; PX ser/thr kinase v2 ; PX serine/threonine kinase ; Pxk; PXK_HUMAN
Target Background
This gene encodes a phox (PX) domain-containing protein which may be involved in synaptic transmission and the ligand-induced internalization and degradation of epidermal growth factors. Variations in this gene may be associated with susceptibility to systemic lupus erythematosus (SLE). Alternative splicing results in multiple transcript variants.
Notification