-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PYGL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against PYGL was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
| Cat.No | ADA-11796A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PYGL |
| Target Synonyms | GSD6; PYGL | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, A-431, HepG2, Mouse liver, Rat liver | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 690-847 of human PYGL (NP_002854.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IGTMDGANVEMAEEAGEENLFIFGMRIDDVAALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEAYVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNESNKVNGN | Uniprot ID | P06737 |
Uniprot Id
P06737
Target Species
Human
Target Name
PYGL
Target Full Name
Glycogen phosphorylase, liver form
Target Function
Allosteric enzyme that catalyzes the rate-limiting step in glycogen catabolism, the phosphorolytic cleavage of glycogen to produce glucose-1-phosphate, and plays a central role in maintaining cellular and organismal glucose homeostasis.
Target Involvement
Glycogen storage disease 6 (GSD6)
Target Subcellular Location
Cytoplasm, cytosol.
Target Protein Families
Glycogen phosphorylase family
Target Research Area
Metabolism
Target Synonyms
Glycogen phosphorylase; Glycogen phosphorylase L; Glycogen phosphorylase liver; Glycogen phosphorylase liver form; GSD6; Hers disease; glycogen storage disease type VI; liver form; OTTHUMP00000233649; OTTHUMP00000233651; Phosphorylase glycogen liver; Pygl; PYGL_HUMAN
Target Background
This gene encodes a homodimeric protein that catalyses the cleavage of alpha-1, 4-glucosidic bonds to release glucose-1-phosphate from liver glycogen stores. This protein switches from inactive phosphorylase B to active phosphorylase A by phosphorylation of serine residue 15. Activity of this enzyme is further regulated by multiple allosteric effectors and hormonal controls. Humans have three glycogen phosphorylase genes that encode distinct isozymes that are primarily expressed in liver, brain and muscle, respectively. The liver isozyme serves the glycemic demands of the body in general while the brain and muscle isozymes supply just those tissues. In glycogen storage disease type VI, also known as Hers disease, mutations in liver glycogen phosphorylase inhibit the conversion of glycogen to glucose and results in moderate hypoglycemia, mild ketosis, growth retardation and hepatomegaly. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification