Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Pyruvate carboxylase (PC) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyruvate carboxylase (PC) (P11498) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Pyruvate carboxylase (PC) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyruvate carboxylase (PC) (P11498) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13994A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Pyruvate carboxylase (PC) |
| Target Synonyms | PCB; PC; Pyruvate carboxylase (PC) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, HepG2, Mouse brain, Mouse liver, Rat liver | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Pyruvate carboxylase (PC) (P11498). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MLKFRTVHGGLRLLGIRRTSTAPAASPNVRRLEYKPIKKVMVANRGEIAIRVFRACTELGIRTVAIYSEQDTGQMHRQKADEAYLIGRGLAPVQAYLHIP | Uniprot ID | P11498 |
Uniprot Id
P11498
Target Species
Human
Target Name
PC
Target Full Name
Pyruvate carboxylase, mitochondrial
Target Function
Pyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second. Catalyzes in a tissue specific manner, the initial reactions of glucose (liver, kidney) and lipid (adipose tissue, liver, brain) synthesis from pyruvate.
Target Involvement
Pyruvate carboxylase deficiency (PC deficiency)
Target Subcellular Location
Mitochondrion matrix.
Target Synonyms
mitochondrial; OTTHUMP00000235155; OTTHUMP00000235156; PC; PCB; Pcx; PYC_HUMAN; Pyruvate carboxylase; Pyruvate carboxylase mitochondrial; Pyruvic carboxylase
Target Background
This gene encodes pyruvate carboxylase, which requires biotin and ATP to catalyse the carboxylation of pyruvate to oxaloacetate. The active enzyme is a homotetramer arranged in a tetrahedron which is located exclusively in the mitochondrial matrix. Pyruvate carboxylase is involved in gluconeogenesis, lipogenesis, insulin secretion and synthesis of the neurotransmitter glutamate. Mutations in this gene have been associated with pyruvate carboxylase deficiency. Alternatively spliced transcript variants with different 5' UTRs, but encoding the same protein, have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
