-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB11A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (NP_004654.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RAB11A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (NP_004654.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-09211A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB11A |
| Target Synonyms | YL8; RAB11A | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat, MCF7, SH-SY5Y | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human RAB11A (NP_004654.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ENVERWLKELRDHADSNIVIMLVGNKSDLRHLRAVPTDEARAFAEKNGLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHV | Uniprot ID | P62491 |
Uniprot Id
P62491
Target Species
Human
Target Name
RAB11A
Target Full Name
Ras-related protein Rab-11A
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. The small Rab GTPase RAB11A regulates endocytic recycling. Acts as a major regulator of membrane delivery during cytokinesis. Together with MYO5B and RAB8A participates in epithelial cell polarization. Together with RAB3IP, RAB8A, the exocyst complex, PARD3, PRKCI, ANXA2, CDC42 and DNMBP promotes transcytosis of PODXL to the apical membrane initiation sites (AMIS), apical surface formation and lumenogenesis. Together with MYO5B participates in CFTR trafficking to the plasma membrane and TF (Transferrin) recycling in nonpolarized cells. Required in a complex with MYO5B and RAB11FIP2 for the transport of NPC1L1 to the plasma membrane. Participates in the sorting and basolateral transport of CDH1 from the Golgi apparatus to the plasma membrane. Regulates the recycling of FCGRT (receptor of Fc region of monomeric Ig G) to basolateral membranes. May also play a role in melanosome transport and release from melanocytes.
Target Subcellular Location
Cell membrane; Lipid-anchor. Recycling endosome membrane; Lipid-anchor. Cleavage furrow. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle membrane.
Target Protein Families
Small GTPase superfamily, Rab family
Target Research Area
Cancer
Target Synonyms
MGC1490; Rab 11; Rab 11A; RAB 11A, member oncogene family; Rab-11; RAB11 A; RAB11; Rab11a; RAB11A member RAS oncogene family; Ras related protein Rab 11A; Ras related protein Rab11A; Ras-related protein Rab-11A; RB11A_HUMAN; YL 8; YL8
Target Background
The protein encoded by this gene belongs to the Rab family of the small GTPase superfamily. It is associated with both constitutive and regulated secretory pathways, and may be involved in protein transport. Two transcript variants encoding different isoforms have been found for this gene.
Notification