-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB26 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00244A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB26 |
| Target Synonyms | V46133; RAB26 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse pancreas, Rat kidney, U-87MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human RAB26 (NP_055168.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFY | Uniprot ID | Q9ULW5 |
Uniprot Id
Q9ULW5
Target Species
Human
Target Name
RAB26
Target Full Name
Ras-related protein Rab-26
Target Function
The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different set of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. Mediates transport of ADRA2A and ADRA2B from the Golgi to the cell membrane. Plays a role in the maturation of zymogenic granules and in pepsinogen secretion in the stomach. Plays a role in the secretion of amylase from acinar granules in the parotid gland.
Target Subcellular Location
Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, secretory vesicle membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rab family
Target Tissue Specificity
Predominantly expressed in brain.
Target Synonyms
CATX-8; RAB11c; Rab26; RAB26 member RAS oncogene family; RAB26_HUMAN; Ras related oncogene protein; Ras related protein Rab 26; Ras-associated protein Rab26; Ras-related protein Rab-26; V46133
Target Background
Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).
Notification