Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB37 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 144-223 of human RAB37 (NP_001006639.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB37 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 144-223 of human RAB37 (NP_001006639.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-06099A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB37 |
| Target Synonyms | RAB37 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain, Mouse pancreas, Rat liver, SP2/0 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 144-223 of human RAB37 (NP_001006639.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KADMSSERVIRSEDGETLAREYGVPFLETSAKTGMNVELAFLAIAKELKYRAGHQADEPSFQIRDYVESQKKRSSCCSFM | Uniprot ID | Q96AX2 |
Uniprot Id
Q96AX2
Target Species
Human
Target Name
RAB37
Target Full Name
Ras-related protein Rab-37
Target Subcellular Location
Cytoplasmic vesicle.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
B230331O03Rik; B230354I04Rik; FLJ30284; FLJ32507; GTPase Rab37; MGC157622; OTTMUSP00000003775; RAB 37; Rab37; Rab37 like; RAB37 member RAS oncogene family; RAB37_HUMAN; Ras related protein Rab 37; Ras related protein Rab37; Ras-related protein Rab-37; RP23-342L24.2
Target Background
Rab proteins are low molecular mass GTPases that are critical regulators of vesicle trafficking. For additional background information on Rab proteins, see MIM 179508.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
