Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB39A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human RAB39A (NP_059986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB39A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human RAB39A (NP_059986.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02256A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB39A |
| Target Synonyms | K28; RAB39; RAB39A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse eye, Mouse spleen, Rat eye | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human RAB39A (NP_059986.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SFEHVKDWLEEAKMYVQPFRIVFLLVGHKCDLASQRQVTREEAEKLSADCGMKYIETSAKDATNVEESFTI | Uniprot ID | Q14964 |
Uniprot Id
Q14964
Target Species
Human
Target Name
RAB39A
Target Full Name
Ras-related protein Rab-39A
Target Function
Plays a role in the maturation and acidification of phagosomes that engulf pathogens, such as S.aureus and M.tuberculosis. Plays a role in vesicular trafficking. Plays a role in the fusion of phagosomes with lysosomes. Negatively regulates LPS-induced autophagosome formation in macrophages possibly by implicating PI3K. May be involved in multiple neurite formation.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasmic vesicle, phagosome. Cytoplasmic vesicle, phagosome membrane; Lipid-anchor; Cytoplasmic side. Lysosome. Note=Recruited to phagosomes containing S.aureus or M.tuberculosis.
Target Protein Families
Small GTPase superfamily, Rab family
Target Synonyms
rab related GTP binding protein; Rab-39; Rab39; RAB39A; RAB39A member RAS oncogene family; Ras related protein Rab39A; Ras-related protein Rab-39A; RB39A_HUMAN
Target Background
Predicted to enable GTPase activity. Involved in phagosome acidification and phagosome-lysosome fusion. Located in phagocytic vesicle.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
