Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RAB45 (NP_689786.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB45 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RAB45 (NP_689786.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14584A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB45 |
| Target Synonyms | TSG; RAB45 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562, LNCaP, Mouse stomach, SK-BR-3, T47D | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human RAB45 (NP_689786.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEADGDGEELARLRSVFAACDANRSGRLEREEFRALCTELRVRPADAEAVFQRLDADRDGAITFQEFARGFLGSLRGGRRRDWGPLDPAPAVSEAGPETHDSEEDEGDEDAAAALATSCG | Uniprot ID | Q8IZ41 |
Uniprot Id
Q8IZ41
Target Species
Human
Target Name
RASEF
Target Full Name
Ras and EF-hand domain-containing protein
Target Function
Binds predominantly GDP, and also GTP. Acts as a dynein adapter protein that activates dynein-mediated transport and dynein-dynactin motility on microtubules.
Target Subcellular Location
Cytoplasm, perinuclear region.
Target Protein Families
Small GTPase superfamily, Rab family
Target Tissue Specificity
Down-regulated in cutaneous melanoma cells but not in breast cancer cells.
Target Synonyms
RASEF; RAB45; Ras and EF-hand domain-containing protein; Ras-related protein Rab-45
Target Background
This gene is a member of the Rab family of GTPases that are involved in regulation of membrane traffic. The encoded protein contains an N-terminal EF-hand domain, a coiled-coil motif and a C-terminal Rab domain. A potential role as tumor suppressor has been indicated for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
