Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAB9P40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RAB9P40 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14338A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAB9P40 |
| Target Synonyms | p40; RAB9P40; bA65N13.1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A549, Mouse brain, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 273-372 of human RAB9RAB9P40 (Q7Z6M1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YHTEEQHWTLLKFDTLLPPGRLDHSMCIIPWPVTCASEKEDSNSLTLNHEAEKEDSADKVMSHSGDSHEESQTATLLCLVFGGMNTEGEIYDDCIVTVVD | Uniprot ID | Q7Z6M1 |
Uniprot Id
Q7Z6M1
Target Species
Human
Target Name
RABEPK
Target Full Name
Rab9 effector protein with kelch motifs
Target Function
Rab9 effector required for endosome to trans-Golgi network (TGN) transport.
Target Subcellular Location
Cytoplasm. Endosome membrane.
Target Synonyms
40 kDa Rab9 effector protein; 8430412M01Rik; 9530020d24rik; AV073337; bA65N13.1; C87311; DKFZp686P1077; OTTHUMP00000022126; OTTMUSP00000012898; OTTMUSP00000012899; OTTMUSP00000041318; p40; RAB9 effector p40; Rab9 effector protein with Kelch motifs; RAB9p40; RABEK_HUMAN; RABEPK; RABEPK protein; RGD1310612; RP11 65N13.1; RP23-446N16.2
Target Background
Predicted to be involved in receptor-mediated endocytosis and vesicle docking involved in exocytosis. Predicted to be located in cytoplasmic vesicle; cytosol; and trans-Golgi network membrane.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
