Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RABIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human RABIF (NP_002862.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RABIF was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human RABIF (NP_002862.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05279A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RABIF |
| Target Synonyms | MSS4; RASGFR3; RASGRF3; RABIF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, DU145, Mouse testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-123 of human RABIF (NP_002862.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEPAEQPSELVSAEGRNRKAVLCQRCGSRVLQPGTALFSRRQLFLPSMRKKPALSDGSNPDGDLLQEHWLVEDMFIFENVGFTKDVGNIKFLVCADCEIGPIGWHCLDDKNSFYVALERVSHE | Uniprot ID | P47224 |
Uniprot Id
P47224
Target Species
Human
Target Name
RABIF
Target Full Name
Guanine nucleotide exchange factor MSS4
Target Function
Guanine-nucleotide-releasing protein that acts on members of the SEC4/YPT1/RAB subfamily. Stimulates GDP release from both YPT1, RAB3A and RAB10, but is less active on these proteins than on the SEC4 protein. Might play a general role in vesicular transport.
Target Protein Families
DSS4/MSS4 family
Target Tissue Specificity
Ubiquitous.
Target Synonyms
RABIF; MSS4; RASGRF3; Guanine nucleotide exchange factor MSS4; Rab-interacting factor
Target Background
This gene encodes a member of the SCE4/YPT1/RAB family of small GTP-binding proteins that are involved in the regulation of intracellular vesicular transport. This protein stimulates GTP-GDP exchange in SEC4, and to a lesser extent in YPT1 and RAB3A, and may play a general role in vesicular transport.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
