-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rad21 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ChIP-seq, ELISA.
The antibody against Rad21 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ChIP, ChIP-seq, ELISA.
| Cat.No | ADA-14274A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD21 |
| Target Synonyms | MGS; HR21; MCD1; NXP1; SCC1; CDLS4; hHR21; HRAD21; Rad21 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, NIH/3T3, A549 | Application | ELISA, WB, ChIP, ChIP-seq, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 532-631 of human Rad21 (O60216). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSFLVLKKQQAIELTQEEPYSDIIATPGPRFHII | Uniprot ID | O60216 |
Uniprot Id
O60216
Target Species
Human
Target Name
RAD21
Target Full Name
Double-strand-break repair protein rad21 homolog
Target Function
As a member of the cohesin complex, involved in sister chromatid cohesion from the time of DNA replication in S phase to their segregation in mitosis, a function that is essential for proper chromosome segregation, post-replicative DNA repair, and the prevention of inappropriate recombination between repetitive regions. The cohesin complex may also play a role in spindle pole assembly during mitosis. In interphase, cohesins may function in the control of gene expression by binding to numerous sites within the genome. May control RUNX1 gene expression (Probable). Binds to and represses APOB gene promoter. May play a role in embryonic gut development, possibly through the regulation of enteric neuron development.; May promote apoptosis.
Target Involvement
Cornelia de Lange syndrome 4 (CDLS4)
Target Subcellular Location
[Double-strand-break repair protein rad21 homolog]: Nucleus. Nucleus matrix. Chromosome. Chromosome, centromere. Cytoplasm, cytoskeleton, spindle pole.; [64-kDa C-terminal product]: Cytoplasm, cytosol. Nucleus.
Target Protein Families
Rad21 family
Target Tissue Specificity
Expressed in the gut (at protein level).
Target Synonyms
CDLS4; Double-strand-break repair protein rad21 homolog; hHR21; HR21; HRAD21; KIAA0078; MCD1; Nuclear matrix protein 1; NXP-1; NXP1; Protein involved in DNA double-strand break repair; RAD21; RAD21 homolog (S. pombe); RAD21 homolog; RAD21_HUMAN; Scc1; SCC1 homolog
Target Background
The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protein, which becomes hyperphosphorylated in cell cycle M phase. The highly regulated association of this protein with mitotic chromatin specifically at the centromere region suggests its role in sister chromatid cohesion in mitotic cells.
Notification