Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RAD54B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 781-910 of human RAD54B (NP_036547.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against RAD54B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 781-910 of human RAD54B (NP_036547.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-04568A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD54B |
| Target Synonyms | RDH54; RAD54B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, DU145, HT-29, Jurkat, Mouse testis | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 781-910 of human RAD54B (NP_036547.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGDSLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT | Uniprot ID | Q9Y620 |
Uniprot Id
Q9Y620
Target Species
Human
Target Name
RAD54B
Target Full Name
DNA repair and recombination protein RAD54B
Target Function
Involved in DNA repair and mitotic recombination. May play an active role in recombination processes in concert with other members of the RAD52 epistasis group.
Target Subcellular Location
Nucleus.
Target Protein Families
SNF2/RAD54 helicase family
Target Tissue Specificity
Abundantly expressed in testis and spleen. Relatively low levels observed in thymus, prostate, ovary and colon.
Target Synonyms
RAD54B; DNA repair and recombination protein RAD54B; EC 3.6.4.-; RAD54 homolog B
Target Background
The protein encoded by this gene belongs to the DEAD-like helicase superfamily. It shares similarity with Saccharomyces cerevisiae RAD54 and RDH54, both of which are involved in homologous recombination and repair of DNA. This protein binds to double-stranded DNA, and displays ATPase activity in the presence of DNA. This gene is highly expressed in testis and spleen, which suggests active roles in meiotic and mitotic recombination. Homozygous mutations of this gene were observed in primary lymphoma and colon cancer.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
