-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Ran was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 117-216 of human Ran (P62826) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Ran was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 117-216 of human Ran (P62826) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13858A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAN |
| Target Synonyms | TC4; Gsp1; ARA24; Ran | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, Mouse brain, Mouse spleen, Mouse thymus, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 117-216 of human Ran (P62826). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IVLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPALAAQYEHDLEVAQTTALPDEDDDL | Uniprot ID | P62826 |
Uniprot Id
P62826
Target Species
Human
Target Name
RAN
Target Full Name
GTP-binding nuclear protein Ran
Target Function
GTPase involved in nucleocytoplasmic transport, participating both to the import and the export from the nucleus of proteins and RNAs. Switches between a cytoplasmic GDP- and a nuclear GTP-bound state by nucleotide exchange and GTP hydrolysis. Nuclear import receptors such as importin beta bind their substrates only in the absence of GTP-bound RAN and release them upon direct interaction with GTP-bound RAN, while export receptors behave in the opposite way. Thereby, RAN controls cargo loading and release by transport receptors in the proper compartment and ensures the directionality of the transport. Interaction with RANBP1 induces a conformation change in the complex formed by XPO1 and RAN that triggers the release of the nuclear export signal of cargo proteins. RAN (GTP-bound form) triggers microtubule assembly at mitotic chromosomes and is required for normal mitotic spindle assembly and chromosome segregation. Required for normal progress through mitosis. The complex with BIRC5/survivin plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. Acts as a negative regulator of the kinase activity of VRK1 and VRK2. Enhances AR-mediated transactivation. Transactivation decreases as the poly-Gln length within AR increases.
Target Subcellular Location
Nucleus. Nucleus envelope. Cytoplasm, cytosol. Cytoplasm. Melanosome.
Target Protein Families
Small GTPase superfamily, Ran family
Target Tissue Specificity
Expressed in a variety of tissues.
Target Research Area
Cell Biology
Target Synonyms
Androgen receptor associated protein 24; Androgen receptor-associated protein 24; ARA 24; ARA24; Gsp1; GTP binding nuclear protein RAN; GTP-binding nuclear protein Ran; GTPase Ran; Guanosine triphosphatase Ran; LPS; OK/SW-cl.81; ran; RAN member RAS oncogene family; RAN_HUMAN; RanGTPase; Ras like protein TC4; Ras related nuclear protein; Ras-like protein TC4; Ras-related nuclear protein; RASL2 8; TC 4; TC4
Target Background
RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis and cell cycle progression. Nuclear localization of RAN requires the presence of regulator of chromosome condensation 1 (RCC1). Mutations in RAN disrupt DNA synthesis. Because of its many functions, it is likely that RAN interacts with several other proteins. RAN regulates formation and organization of the microtubule network independently of its role in the nucleus-cytosol exchange of macromolecules. RAN could be a key signaling molecule regulating microtubule polymerization during mitosis. RCC1 generates a high local concentration of RAN-GTP around chromatin which, in turn, induces the local nucleation of microtubules. RAN is an androgen receptor (AR) coactivator that binds differentially with different lengths of polyglutamine within the androgen receptor. Polyglutamine repeat expansion in the AR is linked to Kennedy's disease (X-linked spinal and bulbar muscular atrophy). RAN coactivation of the AR diminishes with polyglutamine expansion within the AR, and this weak coactivation may lead to partial androgen insensitivity during the development of Kennedy's disease.
Notification