-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RARRES3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RARRES3 (NP_004576.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RARRES3 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RARRES3 (NP_004576.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01108A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RARRES3 |
| Target Synonyms | RIG1; TIG3; HRSL4; HRASLS4; PLAAT-4; RARRES3; PLA1/2-3 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RARRES3 (NP_004576.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKV | Uniprot ID | Q9UL19 |
Uniprot Id
Q9UL19
Target Species
Human
Target Name
PLAAT4
Target Full Name
Phospholipase A and acyltransferase 4
Target Function
Exhibits both phospholipase A1/2 and acyltransferase activities. Shows phospholipase A1 (PLA1) and A2 (PLA2), catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids. For most substrates, PLA1 activity is much higher than PLA2 activity. Shows O-acyltransferase activity, catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid. Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs). Promotes keratinocyte differentiation via activation of TGM1.
Target Subcellular Location
Membrane; Single-pass membrane protein.
Target Protein Families
H-rev107 family
Target Tissue Specificity
Widely expressed.
Target Synonyms
HRASLS4; MGC8906; RAR responsive protein TIG3; RAR-responsive protein TIG3; RARRES3; Retinic acid inducible gene 1; Retinoic acid receptor responder (tazarotene induced) 3; Retinoic acid receptor responder protein 3; Retinoid inducible gene 1 protein; Retinoid-inducible gene 1 protein; RIG 1; rig1; Tazarotene induced gene 3 protein; Tazarotene-induced gene 3 protein; TIG 3; TIG3; TIG3_HUMAN
Target Background
Retinoids exert biologic effects such as potent growth inhibitory and cell differentiation activities and are used in the treatment of hyperproliferative dermatological diseases. These effects are mediated by specific nuclear receptor proteins that are members of the steroid and thyroid hormone receptor superfamily of transcriptional regulators. RARRES1, RARRES2, and RARRES3 are genes whose expression is upregulated by the synthetic retinoid tazarotene. RARRES3 is thought act as a tumor suppressor or growth regulator.
Notification