-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBBP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1240-1355 of human RBBP6 (NP_008841.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBBP6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1240-1355 of human RBBP6 (NP_008841.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05460A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBBP6 |
| Target Synonyms | PACT; MY038; P2P-R; RBQ-1; SNAMA; RBBP6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | K-562 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1240-1355 of human RBBP6 (NP_008841.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SKVKQEKVKGKVRRKVTGTEGSSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSKWDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTK | Uniprot ID | Q7Z6E9 |
Uniprot Id
Q7Z6E9
Target Species
Human
Target Name
RBBP6
Target Full Name
E3 ubiquitin-protein ligase RBBP6
Target Function
E3 ubiquitin-protein ligase which promotes ubiquitination of YBX1, leading to its degradation by the proteasome. May play a role as a scaffold protein to promote the assembly of the p53/TP53-MDM2 complex, resulting in increase of MDM2-mediated ubiquitination and degradation of p53/TP53; may function as negative regulator of p53/TP53, leading to both apoptosis and cell growth. Regulates DNA-replication and the stability of chromosomal common fragile sites (CFSs) in a ZBTB38- and MCM10-dependent manner. Controls ZBTB38 protein stability and abundance via ubiquitination and proteasomal degradation, and ZBTB38 in turn negatively regulates the expression of MCM10 which plays an important role in DNA-replication.; (Microbial infection) restricts ebolavirus replication probably by impairing the vp30-NP interaction, and thus viral transcription.
Target Subcellular Location
Nucleus, nucleolus. Chromosome. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Note=Colocalizes with mitotic chromosomes. Colocalizes with NEK6 in the centrosome.
Target Tissue Specificity
Highly expressed in the placenta and testis. Expressed at lower levels in the brain, heart, kidney, liver and lung. Overexpressed in esophageal cancer.
Target Synonyms
DKFZp686P0638; DKFZp761B2423; E3 ubiquitin-protein ligase RBBP6; MY038; P2P R; P2PR; p53 associated cellular protein of testis; p53-associated cellular protein of testis; p53-associated cellular protein, testis-derived; PACT; Proliferation potential related protein; Proliferation potential-related protein; Protein P2P R; Protein P2P-R; Protein P2PR; Protein RBQ 1; Protein RBQ1; RB binding protein 6, ubiquitin ligase; RB binding Q protein 1; RBBP 6; Rbbp6; RBBP6_HUMAN; RBQ 1; RBQ-1; RBQ1; Retinoblastoma binding protein 6 isoform 3; Retinoblastoma binding Q protein 1; Retinoblastoma-binding protein 6; Retinoblastoma-binding Q protein 1; SNAMA; SNAMA, Drosophila, homolog of
Target Background
The retinoblastoma tumor suppressor (pRB) protein binds with many other proteins. In various human cancers, pRB suppresses cellular proliferation and is inactivated. Cell cycle-dependent phosphorylation regulates the activity of pRB. This gene encodes a protein which binds to underphosphorylated but not phosphorylated pRB. Multiple alternatively spliced transcript variants that encode different isoforms have been found for this gene.
Notification