-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBM15B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human RBM15B (NP_037418.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBM15B was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human RBM15B (NP_037418.3) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00886A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBM15B |
| Target Synonyms | OTT3; HsOTT3; HUMAGCGB; RBM15B | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | BT-474, HepG2, HT-29, Mouse lung, Mouse pancreas, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 540-720 of human RBM15B (NP_037418.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DRDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLSSDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGAEERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQL | Uniprot ID | Q8NDT2 |
Uniprot Id
Q8NDT2
Target Species
Human
Target Name
RBM15B
Target Full Name
Putative RNA-binding protein 15B
Target Function
RNA-binding protein that acts as a key regulator of N6-methyladenosine (m6A) methylation of RNAs, thereby regulating different processes, such as alternative splicing of mRNAs and X chromosome inactivation mediated by Xist RNA. Associated component of the WMM complex, a complex that mediates N6-methyladenosine (m6A) methylation of RNAs, a modification that plays a role in the efficiency of mRNA splicing and RNA processing. Plays a key role in m6A methylation, possibly by binding target RNAs and recruiting the WMM complex. Involved in random X inactivation mediated by Xist RNA: acts by binding Xist RNA and recruiting the WMM complex, which mediates m6A methylation, leading to target YTHDC1 reader on Xist RNA and promoting transcription repression activity of Xist. Functions in the regulation of alternative or illicit splicing, possibly by regulating m6A methylation. Inhibits pre-mRNA splicing. Also functions as a mRNA export factor by acting as a cofactor for the nuclear export receptor NXF1
Target Subcellular Location
Nucleus, nucleoplasm. Nucleus speckle. Nucleus envelope.
Target Protein Families
RRM Spen family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
RBM15B; OTT3; Putative RNA-binding protein 15B; One-twenty two protein 3; HsOTT3; HuOTT3; RNA-binding motif protein 15B
Notification