Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBM20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 820-980 of human RBM20 (NP_001127835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RBM20 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 820-980 of human RBM20 (NP_001127835.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using RBM20 Rabbit pAb at 1:400 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 10s.
| Cat.No | ADA-07973A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBM20 |
| Form | Liquid | Species Reactivity | Human |
| Isotype | IgG | Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | 293F, SH-SY5Y |
| Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 820-980 of human RBM20 (NP_001127835.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AKQNEKNKTKRTDRDQEGADDRKENTMAENEAGKEEQEGMEESPQSVGRQEKEAEFSDPENTRTKKEQDWESESEAEGESWYPTNMEELVTVDEVGEEEDFIVEPDIPELEEIVPIDQKDKICPETCLCVTTTLDLDLAQDFPKEGVKAVGNGAAEISLKS | Uniprot ID | Q5T481 |
Uniprot Id
Q5T481
Target Species
Human
Target Name
RBM20
Target Full Name
RNA-binding protein 20
Target Function
RNA-binding protein that acts as a regulator of mRNA splicing of a subset of genes involved in cardiac development. Regulates splicing of TTN (Titin).
Target Involvement
Cardiomyopathy, dilated 1DD (CMD1DD)
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed in the heart.
Target Synonyms
Probable RNA-binding protein 20; Rbm20; RBM20_HUMAN; RNA binding protein 20; RNA-binding motif protein 20
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
