-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBM39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-508 of human RBM39 (NP_001229528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RBM39 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 400-508 of human RBM39 (NP_001229528.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-04857A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBM39 |
| Target Synonyms | HCC1; CAPER; RNPC2; FSAP59; CAPERalpha; RBM39 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, 293T, BxPC-3, LO2, Mouse brain, U-251MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 400-508 of human RBM39 (NP_001229528.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR | Uniprot ID | Q14498 |
Uniprot Id
Q14498
Target Species
Human
Target Name
RBM39
Target Full Name
RNA-binding protein 39
Target Function
RNA-binding protein that acts as a pre-mRNA splicing factor. Acts by promoting exon inclusion via regulation of exon cassette splicing. Also acts as a transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1, independently of the pre-mRNA splicing factor activity.
Target Subcellular Location
Nucleus speckle.
Target Protein Families
Splicing factor SR family
Target Tissue Specificity
Widely expressed. Highly expressed in pancreas, skeletal muscle, lung and brain. Expressed at intermediate level in kidney, liver and heart.
Target Synonyms
CAPER alpha; CAPER; CAPERalpha; CC1.3; Coactivator of activating protein 1 and estrogen receptors; Coactivator of AP1 and ERs; DKFZp781C0423; FLJ44170; HCC 1; Hepatocellular carcinoma protein 1; RBM 39; RBM39; RBM39_HUMAN; RNA binding motif protein 39; RNA binding region (RNP1 RRM) containing 2; RNA binding region containing 2; RNA binding region containing protein 2; RNA-binding motif protein 39; RNA-binding protein 39; RNA-binding region-containing protein 2; RNPC 2; RNPC2; Splicing factor CC1.3; Splicing factor CC1.4; Splicing factor HCC 1; Splicing factor HCC1; Transcription coactivator CAPER
Target Background
This gene encodes a member of the U2AF65 family of proteins. The encoded protein is found in the nucleus, where it co-localizes with core spliceosomal proteins. It has been shown to play a role in both steroid hormone receptor-mediated transcription and alternative splicing, and it is also a transcriptional coregulator of the viral oncoprotein v-Rel. Multiple transcript variants have been observed for this gene. A related pseudogene has been identified on chromosome X.
Notification