Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBMXL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-350 of human RBMXL2 (NP_055284.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against RBMXL2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 175-350 of human RBMXL2 (NP_055284.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of paraffin-embedded human testis using RBMXL2 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.
| Cat.No | ADA-13353A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBMXL2 |
| Target Synonyms | HNRPGT; HNRNPGT; HNRNPG-T; RBMXL2 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 175-350 of human RBMXL2 (NP_055284.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GGMRGRALAVRGRDGYSGPPRREPLPPRRDPYLGPRDEGYSSRDGYSSRDYREPRGFAPSPGEYTHRDYGHSSVRDDCPLRGYSDRDGYGGRDRDYGDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGL | Uniprot ID | O75526 |
Uniprot Id
O75526
Target Species
Human
Target Name
RBMXL2
Target Full Name
RNA-binding motif protein, X-linked-like-2
Target Subcellular Location
Nucleus.
Target Tissue Specificity
Expressed predominantly in spermatocytes and less in round spermatids (at protein level). Expressed in germ cells.
Target Synonyms
Heterogeneous nuclear ribonucleoprotein G T; hnRNP G T; hnRNP G-T; HNRNPG T; HNRNPGT; HNRPGT; RBMX L2; RBMXL 2; RBMXL2; RMXL2_HUMAN; RNA binding motif protein X linked like 2; RNA-binding motif protein; Testes specific heterogenous nuclear ribonucleoprotein G T; Testis-specific heterogeneous nuclear ribonucleoprotein G-T; X-linked-like-2
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
