Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RBP1 (NP_001352869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RBP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RBP1 (NP_001352869.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-01195A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RBP1 |
| Target Synonyms | CRBP; RBPC; CRBP1; CRBPI; hCRBP1; CRABP-I; RBP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, MCF7, Mouse brain, Mouse testis, Rat liver, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human RBP1 (NP_001352869.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDPPAGFVRAGNPAVAAPQSPLSPEGAHFRAAHHPRSTGSRCPGSLQPSRPLVANWLQSLPEMPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEE | Uniprot ID | P09455 |
Uniprot Id
P09455
Target Species
Human
Target Name
RBP1
Target Full Name
Retinol-binding protein 1
Target Function
Cytoplasmic retinol-binding protein. Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis.
Target Subcellular Location
Cytoplasm. Lipid droplet.
Target Protein Families
Calycin superfamily, Fatty-acid binding protein (FABP) family
Target Tissue Specificity
Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver.
Target Synonyms
Cellular retinol binding protein; Cellular retinol-binding protein; Cellular retinol-binding protein I; CRABP I; CRBP; CRBP-I; CRBP1; CRBPI; RBP 1; RBP1; RBPC; RET1_HUMAN; Retinol binding protein 1 cellular; Retinol-binding protein 1
Target Background
This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. Multiple transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
