-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RECK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human RECK (NP_066934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RECK was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human RECK (NP_066934.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02878A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RECK |
| Target Synonyms | ST15; RECK | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, 293T, H460, MCF-7, Mouse lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 110-210 of human RECK (NP_066934.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALECRQACKQASSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQIKAVENYCASISPQLIHCVNNYTQSYPMRNP | Uniprot ID | O95980 |
Uniprot Id
O95980
Target Species
Human
Target Name
RECK
Target Full Name
Reversion-inducing cysteine-rich protein with Kazal motifs
Target Function
Functions together with ADGRA2 to enable brain endothelial cells to selectively respond to Wnt7 signals (WNT7A or WNT7B). Plays a key role in Wnt7-specific responses: required for central nervous system (CNS) angiogenesis and blood-brain barrier regulation. Acts as a Wnt7-specific coactivator of canonical Wnt signaling by decoding Wnt ligands: acts by interacting specifically with the disordered linker region of Wnt7, thereby conferring ligand selectivity for Wnt7. ADGRA2 is then required to deliver RECK-bound Wnt7 to frizzled by assembling a higher-order RECK-ADGRA2-Fzd-LRP5-LRP6 complex. Also acts as a serine protease inhibitor: negatively regulates matrix metalloproteinase-9 (MMP9) by suppressing MMP9 secretion and by direct inhibition of its enzymatic activity. Also inhibits metalloproteinase activity of MMP2 and MMP14 (MT1-MMP).
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Target Tissue Specificity
Expressed in various tissues and untransformed cells. It is undetectable in tumor-derived cell lines and oncogenically transformed cells.
Target Synonyms
hRECK; Membrane anchored glycoprotein (metastasis and invasion); RECK; RECK protein; RECK_HUMAN; Reversion inducing cysteine rich protein with Kazal motifs; Reversion-inducing cysteine-rich protein with Kazal motifs; ST15; Suppression of tumorigenicity 15 (reversion inducing cysteine rich protein with kazal motifs); Suppressor of tumorigenicity 15; Suppressor of tumorigenicity 15 protein
Target Background
The protein encoded by this gene is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis. Several transcript variants encoding different isoforms have been found for this gene.
Notification