Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against REEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-201 of human REEP1 (NP_075063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against REEP1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-201 of human REEP1 (NP_075063.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00053A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | REEP1 |
| Target Synonyms | DSMA6; HMN5B; SPG31; Yip2a; C2orf23; REEP1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse spinal cord | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-201 of human REEP1 (NP_075063.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KEIDDCLVQAKDRSYDALVHFGKRGLNVAATAAVMAASKGQGALSERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESASSSGTA | Uniprot ID | Q9H902 |
Uniprot Id
Q9H902
Target Species
Human
Target Name
REEP1
Target Full Name
Receptor expression-enhancing protein 1
Target Function
Required for endoplasmic reticulum (ER) network formation, shaping and remodeling; it links ER tubules to the cytoskeleton. May also enhance the cell surface expression of odorant receptors. May play a role in long-term axonal maintenance.
Target Involvement
Spastic paraplegia 31, autosomal dominant (SPG31); Neuronopathy, distal hereditary motor, 5B (HMN5B)
Target Subcellular Location
Membrane. Mitochondrion membrane; Multi-pass membrane protein. Endoplasmic reticulum.
Target Protein Families
DP1 family
Target Tissue Specificity
Expressed in circumvallate papillae and testis.
Target Synonyms
REEP1; C2orf23; SPG31; Receptor expression-enhancing protein 1; Spastic paraplegia 31 protein
Target Background
This gene encodes a mitochondrial protein that functions to enhance the cell surface expression of odorant receptors. Mutations in this gene cause spastic paraplegia autosomal dominant type 31, a neurodegenerative disorder. Alternative splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
