Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RETNLB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RETNLB was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-02124A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RETNLB |
| Target Synonyms | XCP2; FIZZ1; FIZZ2; HXCP2; RELMb; RELMbeta; RELM-beta; RETNLB | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human RETNLB (NP_115968.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT | Uniprot ID | Q9BQ08 |
Uniprot Id
Q9BQ08
Target Species
Human
Target Name
RETNLB
Target Full Name
Resistin-like beta
Target Function
Probable hormone.
Target Subcellular Location
Secreted.
Target Protein Families
Resistin/FIZZ family
Target Tissue Specificity
Expressed only in the gastrointestinal tract, particularly the colon.
Target Research Area
Signal Transduction
Target Synonyms
C/EBP epsilon regulated myeloid specific secreted cysteine rich protein precursor 2; CCGR; Colon and small intestine specific cysteine rich protein; Colon and small intestine-specific cysteine-rich protein; Colon carcinoma related gene protein; Colon carcinoma-related gene protein; Cysteine rich secreted A12 alpha like protein 1; Cysteine rich secreted protein A12 alpha like 1; Cysteine rich secreted protein FIZZ2; Cysteine-rich secreted protein A12-alpha-like 1; Cysteine-rich secreted protein FIZZ2; FIZZ1; FIZZ2; Found in inflammatory zone 1; HXCP2; RELM beta; RELMb; RELMbeta; Resistin like beta; Resistin like protein beta; Resistin-like beta; RETNB_HUMAN; RETNL2; Retnlb; XCP2
Target Background
Predicted to enable hormone activity. Involved in epithelial cell proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
