-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rev-erb beta/NR1D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Rev-erb beta/NR1D2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14731A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Rev-erb beta/NR1D2 |
| Target Synonyms | RVR; BD73; EAR-1R; REVERBB; REVERBbeta; Rev-erb beta/NR1D2 | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse skeletal muscle, Rat lung | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-300 of human Rev-erb beta/NR1D2 (NP_005117.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ALPAQEQLRPKPQLEQENIKSSSPPSSDFAKEEVIGMVTRAHKDTFMYNQEQQENSAESMQPQRGERIPKNMEQYNLNHDH | Uniprot ID | Q14995 |
Uniprot Id
Q14995
Target Species
Human
Target Name
NR1D2
Target Full Name
Nuclear receptor subfamily 1 group D member 2
Target Function
Transcriptional repressor which coordinates circadian rhythm and metabolic pathways in a heme-dependent manner. Integral component of the complex transcription machinery that governs circadian rhythmicity and forms a critical negative limb of the circadian clock by directly repressing the expression of core clock components ARNTL/BMAL1 and CLOCK. Also regulates genes involved in metabolic functions, including lipid metabolism and the inflammatory response. Acts as a receptor for heme which stimulates its interaction with the NCOR1/HDAC3 corepressor complex, enhancing transcriptional repression. Recognizes two classes of DNA response elements within the promoter of its target genes and can bind to DNA as either monomers or homodimers, depending on the nature of the response element. Binds as a monomer to a response element composed of the consensus half-site motif 5'-[A/G]GGTCA-3' preceded by an A/T-rich 5' sequence (RevRE), or as a homodimer to a direct repeat of the core motif spaced by two nuclegotides (RevDR-2). Acts as a potent competitive repressor of ROR alpha (RORA) function and also negatively regulates the expression of NR1D1. Regulates lipid and energy homeostasis in the skeletal muscle via repression of genes involved in lipid metabolism and myogenesis including: CD36, FABP3, FABP4, UCP3, SCD1 and MSTN. Regulates hepatic lipid metabolism via the repression of APOC3. Represses gene expression at a distance in macrophages by inhibiting the transcription of enhancer-derived RNAs (eRNAs). In addition to its activity as a repressor, can also act as a transcriptional activator. Acts as a transcriptional activator of the sterol regulatory element-binding protein 1 (SREBF1) and the inflammatory mediator interleukin-6 (IL6) in the skeletal muscle. Plays a role in the regulation of circadian sleep/wake cycle; essential for maintaining wakefulness during the dark phase or active period. Key regulator of skeletal muscle mitochondrial function; negatively regulates the skeletal muscle expression of core clock genes and genes involved in mitochondrial biogenesis, fatty acid beta-oxidation and lipid metabolism. May play a role in the circadian control of neutrophilic inflammation in the lung
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
Nuclear hormone receptor family, NR1 subfamily
Target Tissue Specificity
Widely expressed. Expressed at high levels in the liver, adipose tissue, skeletal muscle and brain. Expression oscillates diurnally in the suprachiasmatic nucleus (SCN) of the hypothalamus as well as in peripheral tissues.
Target Synonyms
BD73; EAR 1R; EAR-1R; HZF2; Nr1d2; NR1D2_HUMAN; Nuclear receptor Rev ErbA beta variant 1; Nuclear receptor Rev ErbA beta variant 2; Nuclear receptor subfamily 1 group D member 2; Orphan nuclear hormone receptor BD73; Rev erb beta; Rev erba alpha related receptor; Rev-erb-beta; REVB; REVERBB; RVR; V-erbA-related protein 1-related
Notification