Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RFC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-340 of human RFC5 (NP_031396.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RFC5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 181-340 of human RFC5 (NP_031396.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01804A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RFC5 |
| Target Synonyms | RFC36; RFC5 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, MCF-7, Mouse liver, Mouse spleen, SKOV3, U-251MG | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 181-340 of human RFC5 (NP_031396.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LMVPRLEHVVEEEKVDISEDGMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANILDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHLLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA | Uniprot ID | P40937 |
Uniprot Id
P40937
Target Species
Human
Target Name
RFC5
Target Full Name
Replication factor C subunit 5
Target Function
The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.
Target Subcellular Location
Nucleus.
Target Protein Families
Activator 1 small subunits family
Target Synonyms
36 kDa subunit; A1 36; A1 36 kDa subunit; Activator 1 36 kDa subunit; Activator 1; Activator 1 subunit 5; MGC1155; Replication factor C (activator 1) 5 (36.5kD) ; Replication factor C 36 kDa subunit; Replication factor C 5 isoform 1; Replication Factor C; Replication factor C subunit 5; replication factor C, 36-kDa subunit; RF-C 36 kDa subunit; RFC 36.5 kD subunit ; RFC 5; RFC3, yeast, homolog of; RFC36; rfc5; RFC5_HUMAN
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
