Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RGL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human RGL1 (NP_001284600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RGL1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-400 of human RGL1 (NP_001284600.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-05846A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RGL1 |
| Target Synonyms | RGL; RGL1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, 293T, Jurkat, Mouse brain, Mouse testis, Rat testis, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human RGL1 (NP_001284600.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LKTQQRAKIIEKWINIAHECRLLKNFSSLRAIVSALQSNSIYRLKKTWAAVPRDRMLMFEELSDIFSDHNNHLTSRELLMKEGTSKFANLDSSVKENQKRT | Uniprot ID | Q9NZL6 |
Uniprot Id
Q9NZL6
Target Species
Human
Target Name
RGL1
Target Full Name
Ral guanine nucleotide dissociation stimulator-like 1
Target Function
Probable guanine nucleotide exchange factor.
Target Tissue Specificity
Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis.
Target Synonyms
RGL1; KIAA0959; RGL; Ral guanine nucleotide dissociation stimulator-like 1; RalGDS-like 1
Target Background
Predicted to be involved in regulation of catalytic activity. Predicted to be located in cytosol.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
