Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RGS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human RGS5 (NP_003608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RGS5 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human RGS5 (NP_003608.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-02741A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RGS5 |
| Target Synonyms | MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; RGS5 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-181 of human RGS5 (NP_003608.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK | Uniprot ID | O15539 |
Uniprot Id
O15539
Target Species
Human
Target Name
RGS5
Target Full Name
Regulator of G-protein signaling 5
Target Function
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to G(i)-alpha and G(o)-alpha, but not to G(s)-alpha.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Membrane.; [Isoform 2]: Cytoplasm.
Target Research Area
Signal Transduction
Target Synonyms
MST092; MST106; MST129; MSTP032; MSTP092; MSTP106; MSTP129; Regulator of G Protein Signalling 5; Regulator of G-protein signaling 5; RGS 5; RGS5; RGS5_HUMAN
Target Background
This locus represents naturally occurring readthrough transcription between the neighboring LOC127814295 (uncharacterized LOC127814295) and RGS5 (regulator of G-protein signaling 5) genes on chromosome 1. Some variants of the readthrough transcript encode novel proteins with unique N-termini.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
