-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RGS9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-350 of human RGS9 (NP_003826.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RGS9 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 230-350 of human RGS9 (NP_003826.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-01003A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RGS9 |
| Target Synonyms | PERRS; RGS9L; RGS9 | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse brain | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 230-350 of human RGS9 (NP_003826.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MYYQQALMRSTVKSSVSLGGIVKYSEQFSSNDAIMSGCLPSNPWITDDTQFWDLNAKLVEIPTKMRVERWAFNFSELIRDPKGRQSFQYFLKKEFSGENLGFWEACEDLKYGDQSKVKEKA | Uniprot ID | O75916 |
Uniprot Id
O75916
Target Species
Human
Target Name
RGS9
Target Full Name
Regulator of G-protein signaling 9
Target Function
Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Binds to GNAT1. Involved in phototransduction; key element in the recovery phase of visual transduction.
Target Involvement
Prolonged electroretinal response suppression (PERRS)
Target Subcellular Location
[Isoform 3]: Membrane; Peripheral membrane protein.
Target Tissue Specificity
Highly expressed in the caudate and putamen, lower levels found in the hypothalamus and nucleus accumbens and very low levels in cerebellum. Not expressed in globus pallidus or cingulate cortex. Isoform 2 is expressed predominantly in pineal gland and ret
Target Synonyms
PERRS; R9AP; Regulator of G protein signalling 9; Regulator of G-protein signaling 9; RGS9; RGS9_HUMAN; RGS9L
Target Background
This gene encodes a member of the RGS family of GTPase activating proteins that function in various signaling pathways by accelerating the deactivation of G proteins. This protein is anchored to photoreceptor membranes in retinal cells and deactivates G proteins in the rod and cone phototransduction cascades. Mutations in this gene result in bradyopsia. Multiple transcript variants encoding different isoforms have been found for this gene.
Notification