-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHBDD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 206-315 of human RHBDD1 (NP_115652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RHBDD1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 206-315 of human RHBDD1 (NP_115652.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-05701A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHBDD1 |
| Target Synonyms | RRP4; RHBDL4; RHBDD1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney, Rat brain, BxPC-3, Mouse brain, Raji, U-87MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 206-315 of human RHBDD1 (NP_115652.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TQGPLKKIMEACAGGFSSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ | Uniprot ID | Q8TEB9 |
Uniprot Id
Q8TEB9
Target Species
Human
Target Name
RHBDD1
Target Full Name
Rhomboid-related protein 4
Target Function
Intramembrane-cleaving serine protease that cleaves single transmembrane or multi-pass membrane proteins in the hydrophobic plane of the membrane, luminal loops and juxtamembrane regions. Involved in regulated intramembrane proteolysis and the subsequent release of functional polypeptides from their membrane anchors. Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded membrane proteins. Required for the degradation process of some specific misfolded endoplasmic reticulum (ER) luminal proteins. Participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. Functions in BIK, MPZ, PKD1, PTCRA, RHO, STEAP3 and TRAC processing. Involved in the regulation of exosomal secretion; inhibits the TSAP6-mediated secretion pathway. Involved in the regulation of apoptosis; modulates BIK-mediated apoptotic activity. Also plays a role in the regulation of spermatogenesis; inhibits apoptotic activity in spermatogonia.
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion membrane; Multi-pass membrane protein.
Target Protein Families
Peptidase S54 family
Target Tissue Specificity
Expressed strongly in testis.
Target Synonyms
RHBDD1; RHBDL4; HSD-50; HSD50; Rhomboid-related protein 4; RRP4; Rhomboid domain-containing protein 1; Rhomboid-like protein 4
Target Background
Enables serine-type endopeptidase activity. Involved in several processes, including cellular response to unfolded protein; membrane protein proteolysis; and positive regulation of protein catabolic process. Located in endoplasmic reticulum.
Notification