Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RheB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RheB (Q15382) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
The antibody against RheB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RheB (Q15382) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IF/ICC, ELISA.
Immunofluorescence analysis of NIH-3T3 cells using RheB Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Cat.No | ADA-13803A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHEB |
| Target Synonyms | RHEB2; RheB | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RheB (Q15382). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVDTAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIH | Uniprot ID | Q15382 |
Uniprot Id
Q15382
Target Species
Human
Target Name
RHEB
Target Full Name
GTP-binding protein Rheb
Target Function
Activates the protein kinase activity of mTORC1, and thereby plays a role in the regulation of apoptosis. Stimulates the phosphorylation of S6K1 and EIF4EBP1 through activation of mTORC1 signaling. Has low intrinsic GTPase activity.
Target Subcellular Location
Endomembrane system; Lipid-anchor; Cytoplasmic side. Golgi apparatus membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytosol. Endoplasmic reticulum membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rheb family
Target Tissue Specificity
Ubiquitous. Highest levels observed in skeletal and cardiac muscle.
Target Synonyms
as homolog enriched in brain 2; formerly; GTP binding protein Rheb; GTP-binding protein Rheb; MGC111559; Ras homolog enriched in brain 2; Ras homolog enriched in brain; RHEB 2; Rheb; RHEB_HUMAN; RHEB2; RHEB2; formerly
Target Background
This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region. This protein is vital in regulation of growth and cell cycle progression due to its role in the insulin/TOR/S6K signaling pathway. The protein has GTPase activity and shuttles between a GDP-bound form and a GTP-bound form, and farnesylation of the protein is required for this activity. Three pseudogenes have been mapped, two on chromosome 10 and one on chromosome 22.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
