Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHOBTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human RHOBTB1 (NP_055651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RHOBTB1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human RHOBTB1 (NP_055651.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00846A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOBTB1 |
| Target Synonyms | RHOBTB1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse kidney, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 240-400 of human RHOBTB1 (NP_055651.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PPVIKIPECPSMGTNEAACLLDNPLCADVLFILQDQEHIFAHRIYLATSSSKFYDLFLMECEESPNGSEGACEKEKQSRDFQGRILSVDPEEEREEGPPRIPQADQWKSSNKSLVEALGLEAEGAVPETQTLTGWSKGFIGMHREMQVNPISKRMGPMTVV | Uniprot ID | O94844 |
Uniprot Id
O94844
Target Species
Human
Target Name
RHOBTB1
Target Full Name
Rho-related BTB domain-containing protein 1
Target Synonyms
1700008H16Rik; 3110048G13Rik; AI173445; AI573858; AV350930; KIAA0740; MGC107538; MGC33059; MGC33841 ; OTTHUMP00000019662 ; OTTHUMP00000019663 ; RHBT1_HUMAN; Rho related BTB domain containing 1; Rho related BTB domain containing protein 1; Rho-related BTB domain-containing protein 1; Rhobtb1
Target Background
The protein encoded by this gene belongs to the Rho family of the small GTPase superfamily. It contains a GTPase domain, a proline-rich region, a tandem of 2 BTB (broad complex, tramtrack, and bric-a-brac) domains, and a conserved C-terminal region. The protein plays a role in small GTPase-mediated signal transduction and the organization of the actin filament system. Alternate splicing results in multiple transcript variants.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
