Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHOBTB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-480 of human RHOBTB2 (NP_001153508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against RHOBTB2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 320-480 of human RHOBTB2 (NP_001153508.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-07286A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOBTB2 |
| Target Synonyms | p83; DBC2; DEE64; EIEE64; RHOBTB2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat lung | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 320-480 of human RHOBTB2 (NP_001153508.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDLSEGELGGPSEPGGTHPEDHQGHSDQHHHHHHHHHGRDFLLRAASFDVCESVDEAGGSGPAGLRASTSDGILRGNGTGYLPGRGRVLSSWSRAFVSIQEEMAEDPLTYKSRLMVVVKMDSSIQPGPFRAVLKYLYTGELDENERDLMHIAHIAELLEVF | Uniprot ID | Q9BYZ6 |
Uniprot Id
Q9BYZ6
Target Species
Human
Target Name
RHOBTB2
Target Full Name
Rho-related BTB domain-containing protein 2
Target Synonyms
DBC 2; Deleted in breast cancer 2; Deleted in breast cancer 2 gene protein; p83; RHBT2_HUMAN; Rho related BTB domain containing 2; Rho related BTB domain containing protein 2; Rho-related BTB domain-containing protein 2; RHOBTB 2; Rhobtb2
Target Background
The protein encoded by this gene is a small Rho GTPase and a candidate tumor suppressor. The encoded protein interacts with the cullin-3 protein, a ubiquitin E3 ligase necessary for mitotic cell division. This protein inhibits the growth and spread of some types of breast cancer. Three transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
