-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RhoC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_786886.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RhoC was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_786886.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16478A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOC |
| Target Synonyms | H9; ARH9; ARHC; RHOH9; oC | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat heart, 293T | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-193 of human RhoC (NP_786886.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGCPIL | Uniprot ID | P08134 |
Uniprot Id
P08134
Target Species
Human
Target Name
RHOC
Target Full Name
Rho-related GTP-binding protein RhoC
Target Function
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cleavage furrow. Note=Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.
Target Protein Families
Small GTPase superfamily, Rho family
Target Synonyms
Aplysia RAS-related homolog 9; ARH 9; ARH9; ARHC; H9; MGC1448; MGC61427; Oncogene RHO H9; Ras homolog gene family member C; RAS related homolog 9; RHO C; Rho cDNA clone 9; Rho related GTP binding protein RhoC; Rho-related GTP-binding protein RhoC; rhoC; RhoC GTPase; RHOC_HUMAN; RHOH 9; RHOH9; Small GTP binding protein RhoC
Target Background
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification