Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rhodopsin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Rhodopsin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-11395A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Rhodopsin |
| Target Synonyms | RP4; OPN2; CSNBAD1; Rhodopsin | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse eye, Rat eye | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human Rhodopsindopsin (NP_000530.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NESFVIYMFVVHFTIPMIIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIAFLICWVPYASVAFYIFTHQGSNFGPIFMTIPAFFAKSAAIYNPVIYIMMNKQFRNCMLTTICCGKNPLGDDEASATVSKTETSQVAPA | Uniprot ID | P08100 |
Uniprot Id
P08100
Target Species
Human
Target Name
RHO
Target Full Name
Rhodopsin
Target Function
Photoreceptor required for image-forming vision at low light intensity. Required for photoreceptor cell viability after birth. Light-induced isomerization of the chromophore 11-cis-retinal to all-trans-retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by the arrestin SAG and terminates signaling.
Target Involvement
Retinitis pigmentosa 4 (RP4); Night blindness, congenital stationary, autosomal dominant 1 (CSNBAD1)
Target Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment.
Target Protein Families
G-protein coupled receptor 1 family, Opsin subfamily
Target Tissue Specificity
Rod shaped photoreceptor cells which mediate vision in dim light.
Target Research Area
Signal Transduction
Target Synonyms
CSNBAD1; MGC138309; MGC138311; OPN 2; OPN2; opsd; OPSD_HUMAN; opsin 2; Opsin 2 rod pigment; Opsin-2; Opsin2; Retinitis Pigmentosa 4; Retinitis pigmentosa 4 autosomal dominant; RHO; Rhodopsin; RP 4; RP4
Target Background
The protein encoded by this gene is found in rod cells in the back of the eye and is essential for vision in low-light conditions. The encoded protein binds to 11-cis retinal and is activated when light hits the retinal molecule. Defects in this gene are a cause of congenital stationary night blindness.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
