-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RHOG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human RHOG (NP_001656.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RHOG was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human RHOG (NP_001656.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-07373A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RHOG |
| Target Synonyms | ARHG; RHOG | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human RHOG (NP_001656.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIH | Uniprot ID | P84095 |
Uniprot Id
P84095
Target Species
Human
Target Name
RHOG
Target Full Name
Rho-related GTP-binding protein RhoG
Target Function
Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.
Target Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side.
Target Protein Families
Small GTPase superfamily, Rho family
Target Research Area
Signal Transduction
Target Synonyms
ARHG; Ras homolog family member G; Rho G; Rho related GTP binding protein RhoG precursor ; Rho-related GTP-binding protein RhoG; RHOG; RHOG_HUMAN
Target Background
This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The encoded protein facilitates translocation of a functional guanine nucleotide exchange factor (GEF) complex from the cytoplasm to the plasma membrane where ras-related C3 botulinum toxin substrate 1 is activated to promote lamellipodium formation and cell migration. Two related pseudogene have been identified on chromosomes 20 and X.
Notification