Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RhoGAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human RhoGAP (Q13017) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against RhoGAP was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human RhoGAP (Q13017) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14123A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RhoGAP |
| Target Synonyms | GFI2; p190-B; RhoGAP5; p190BRhoGAP; RhoGAP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, C2C12, MCF7, Mouse brain | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1150-1300 of human RhoGAP (Q13017). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PSKYKYKSKTLFSKAKSYYRRTHSDASDDEAFTTSKTKRKGRHRGSEEDPLLSPVETWKGGIDNPAITSDQELDDKKMKKKTHKVKEDKKQKKKTKNFNPPTRRNWESNYFGMPLQDLVTAEKPIPLFVEKCVEFIEDTGLCTEGLYRVSG | Uniprot ID | Q13017 |
Uniprot Id
Q13017
Target Species
Human
Target Name
ARHGAP5
Target Full Name
Rho GTPase-activating protein 5
Target Function
GTPase-activating protein for Rho family members.
Target Subcellular Location
Cytoplasm. Cell membrane; Peripheral membrane protein.
Target Tissue Specificity
Detected in skin fibroblasts (at protein level).
Target Synonyms
Arhgap5; p190-B; RHG05_HUMAN; Rho GTPase activating protein 5; Rho GTPase-activating protein 5; Rho-type GTPase-activating protein 5
Target Background
Rho GTPase activating protein 5 negatively regulates RHO GTPases, a family which may mediate cytoskeleton changes by stimulating the hydrolysis of bound GTP. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
