Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RICTOR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1043-1142 of human RICTOR (NP_689969.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RICTOR was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1043-1142 of human RICTOR (NP_689969.2) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-10417A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RICTOR |
| Target Synonyms | PIA; AVO3; hAVO3; RICTOR | Form | Liquid |
| Species Reactivity | Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | PC-12 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1043-1142 of human RICTOR (NP_689969.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIKDKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVDFN | Uniprot ID | Q6R327 |
Uniprot Id
Q6R327
Target Species
Human
Target Name
RICTOR
Target Full Name
Rapamycin-insensitive companion of mTOR
Target Function
Subunit of mTORC2, which regulates cell growth and survival in response to hormonal signals. mTORC2 is activated by growth factors, but, in contrast to mTORC1, seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'. Plays an essential role in embryonic growth and development.
Target Protein Families
RICTOR family
Target Synonyms
AVO3; AVO3 homolog; DKFZp686B11164 ; hAVO3; KIAA1999; Likely ortholog of mouse TORC2 specific protein AVO3 (S. cerevisiae); mAVO3; MGC39830; PIA; Pianissimo; Rapamycin insensitive companion of mTOR ; Rapamycin-insensitive companion of mTOR; Rictor; RICTR; RICTR_HUMAN; RPTOR independent companion of MTOR complex 2; TORC2 specific protein AVO3
Target Background
RICTOR and MTOR (FRAP1; MIM 601231) are components of a protein complex that integrates nutrient- and growth factor-derived signals to regulate cell growth (Sarbassov et al., 2004 [PubMed 15268862]).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
