Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RMND5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against RMND5A was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-00611A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RMND5A |
| Target Synonyms | CTLH; GID2; RMD5; GID2A; p44CTLH; RMND5A | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse stomach, Rat spleen, SGC-7901 | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 200-270 of human RMND5A (NP_073617.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ISLLMGGTTNQREALQYAKNFQPFALNHQKDIQVLMGSLVYLRQGIENSPYVHLLDANQWADICDIFTRDA | Uniprot ID | Q9H871 |
Uniprot Id
Q9H871
Target Species
Human
Target Name
RMND5A
Target Full Name
E3 ubiquitin-protein transferase RMND5A
Target Function
Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex. Catalytic activity of the complex is required for normal cell proliferation. The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1.
Target Subcellular Location
Nucleus, nucleoplasm. Cytoplasm.
Target Research Area
Others
Target Synonyms
RMND5A; E3 ubiquitin-protein transferase RMND5A; EC 2.3.2.27; P44CTLH; Protein RMD5 homolog A
Target Background
Predicted to enable metal ion binding activity and ubiquitin protein ligase activity. Predicted to contribute to ubiquitin-protein transferase activity. Predicted to be involved in proteasome-mediated ubiquitin-dependent protein catabolic process and protein polyubiquitination. Located in cytoplasm and nucleoplasm. Part of ubiquitin ligase complex.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
