Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RNASE6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human RNASE6 (NP_005606.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against RNASE6 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human RNASE6 (NP_005606.1) as the immunogen. The polyclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-05147A | Clonality | Polyclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RNASE6 |
| Target Synonyms | RAD1; RNS6; RNasek6; RNASE6 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, PBS with 0.01% thimerosal, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human RNASE6 (NP_005606.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL | Uniprot ID | Q93091 |
Uniprot Id
Q93091
Target Species
Human
Target Name
RNASE6
Target Full Name
Ribonuclease K6
Target Function
Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.
Target Subcellular Location
Secreted. Lysosome. Cytoplasmic granule.
Target Protein Families
Pancreatic ribonuclease family
Target Tissue Specificity
Highly expressed in spleen (at protein level). Has little or no expression in healthy kidneys (at protein level). Detected in interstitial leukocytes in infected kidneys (at protein level). Expressed in ureter where it localizes to urothelial and submucos
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
RNASE6; RNS6; Ribonuclease K6; RNase K6; EC 3.1.27.-
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
